DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or67a

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster


Alignment Length:412 Identity:87/412 - (21%)
Similarity:169/412 - (41%) Gaps:47/412 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KKQEEKDQSLRVQILVYRCMGIDLWSPTMANDRPWLTFVTMGPLFLFMVPMFLAAHEYITQVSLL 72
            :|..|.|..||:.:..|..:|||.:. |......|..       ..|.:.||.....:..:|:.|
  Fly    10 EKYVEVDDFLRLAVKFYNTLGIDPYE-TGRKRTIWFQ-------IYFALNMFNMVFSFYAEVATL 66

  Fly    73 SDTL--GSTFASMLTLVKFLLFCYHRKEFVGLIYHIR---AILAKEIEV-WPDAREIIEVENQSD 131
            .|.|  ...|.....|:.::.|.......:|.:...:   ..|.:::|. :|.....::.|....
  Fly    67 VDRLRDNENFLESCILLSYVSFVVMGLSKIGAVMKKKPKMTALVRQLETCFPSPSAKVQEEYAVK 131

  Fly   132 QMLSL--TYTRCFGLAGIFAAL---KPFVGIILSSIRGDEIHLE-----LPHNGVYPYDLQVVMF 186
            ..|..  .||:.||  |:|..:   ...:.:.:..|:...:|..     :|...:.|::.:....
  Fly   132 SWLKRCHIYTKGFG--GLFMIMYFAHALIPLFIYFIQRVLLHYPDAKQIMPFYQLEPWEFRDSWL 194

  Fly   187 YVPTYLWNVMASYSAVTMALCVDSLLFFFTY----------NVCAIFKIAKHRMIHLPAVGGKEE 241
            :.|:|.....|.|:|...::..|.::|....          .|...|||..|...:    |.||:
  Fly   195 FYPSYFHQSSAGYTATCGSIAGDLMIFAVVLQVIMHYERLAKVLREFKIQAHNAPN----GAKED 255

  Fly   242 LEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYF---IAF 303
            :..|..::..|...|::.|.:.:.:...:.|.|..|||.:|.:|.|:. :..:|:  ||   :.|
  Fly   256 IRKLQSLVANHIDILRLTDLMNEVFGIPLLLNFIASALLVCLVGVQLT-IALSPE--YFCKQMLF 317

  Fly   304 VGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRP-CQMKGYFFE 367
            :.|:|:.:::.....:.:..||.:.|:..|:.:|.......|:.|:..:||:|:| |.......:
  Fly   318 LISVLLEVYLLCSFSQRLIDASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKATVVLD 382

  Fly   368 ASMATFSTIVRSAVSYIMMLRS 389
            .||.|.|..:..:..:...:|:
  Fly   383 LSMPTMSIFLGMSYKFFCAVRT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 72/342 (21%)
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 68/329 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.