DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or63a

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:419 Identity:87/419 - (20%)
Similarity:169/419 - (40%) Gaps:58/419 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QSLRVQILVYRCMGIDLWSPTMAND--RPWLTFVTMGPLFLFMVPMFLAAH-----EYITQVSLL 72
            :|:|..|.:...:|.:|..|:....  |.|...:::..|      ..|..|     .||..:..:
  Fly    16 RSIREMIRLSYTVGFNLLDPSRCGQVLRIWTIVLSVSSL------ASLYGHWQMLARYIHDIPRI 74

  Fly    73 SDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRA--ILAK-EI-EVWPDAREIIEVENQSDQM 133
            .:|.|:....:.::.|...|.:..::...|:...|.  :|.| |: |...|...|.|:..|.:..
  Fly    75 GETAGTALQFLTSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEIRQQVEST 139

  Fly   134 LSLTY--TRCFGLAGIFAALKPFVGIILSSI-----------RGD-EIHLELP-------HNGV- 176
            ::..:  ||...|..:::.:.......::|.           :|. :|.|.||       |.|: 
  Fly   140 MNRYWASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGLE 204

  Fly   177 YP-YDLQVVMFYVPTYLWNVMA-SYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPA---V 236
            :| |.:|:.:.....|:..:.| |:..|.:.||:.|:....:.|          :|:....   |
  Fly   205 FPYYHIQMYLETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLN----------QMVEQATSELV 259

  Fly   237 GGKEELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYFI 301
            .....:|.|...:..:|:....|..:.:.:|.:.|.||.||........||::....|..|:..|
  Fly   260 PPDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSITMI 324

  Fly   302 AFVGSLLIA---LFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQMK- 362
            .....|:.|   :.:|...|:...:||.:..|..|:..|...|...:..:.:..||..|..::. 
  Fly   325 RMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDV 389

  Fly   363 GYFFEASMATFSTIVRSAVSYIMMLRSFN 391
            .:|.:.|:.|...:||::..|.::|::.|
  Fly   390 SWFMQMSLPTLMAMVRTSGQYFLLLQNVN 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 71/347 (20%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 71/341 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.