DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or56a

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:440 Identity:91/440 - (20%)
Similarity:165/440 - (37%) Gaps:113/440 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LWSPTMANDR---------PWLTFVTM----GPLFLFMVPMFLAAHEYITQVSLLS------DTL 76
            |.|||...|.         .|..:|..    .||...:....|.|..:::...:|:      :.|
  Fly     8 LLSPTTFEDPIFGTHLRYFQWYGYVASKDQNRPLLSLIRCTILTASIWLSCALMLARVFRGYENL 72

  Fly    77 GSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREII-EVENQSDQMLSLT--Y 138
            .....|..|.|::  |......|...:...:.|....: ...|.:.:: |.:|:..::|..|  |
  Fly    73 NDGATSYATAVQY--FAVSIAMFNAYVQRDKVISLLRV-AHSDIQNLMHEADNREMELLVATQAY 134

  Fly   139 TRCFGL----AGIFAALKPFVGIILSSI-------------RGDEIHLELPHNGVYPY----DLQ 182
            ||...|    ..:.|.|..:...|..|:             ||:|..:.|..  ::|:    |..
  Fly   135 TRTITLLIWIPSVIAGLMAYSDCIYRSLFLPKSVFNVPAVRRGEEHPILLFQ--LFPFGELCDNF 197

  Fly   183 VVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPAVGGK-EELEGLV 246
            ||.:..|.|           .:.|.:.::..:.|:..|    :.|:..:.|..:..: ||::   
  Fly   198 VVGYLGPWY-----------ALGLGITAIPLWHTFITC----LMKYVNLKLQILNKRVEEMD--- 244

  Fly   247 QVLLLHQK--------------GLQI-ADHIADKYRPLIFLQ-------------FFLSALQICF 283
             :..|:.|              .:|: .:.:.::.|...|:|             |.:.::.|||
  Fly   245 -ITRLNSKLVIGRLTASELTFWQMQLFKEFVKEQLRIRKFVQELQYLICVPVMADFIIFSVLICF 308

  Fly   284 IGFQVADLFPNPQSLYFIAFVGSLLIA--LFIYS-------KCGENIKSASLDFGNGLYETNWTD 339
            :.|.:....|:... ||..|:...::|  |:||.       :|.:.:..|....|       |.:
  Fly   309 LFFALTVGVPSKMD-YFFMFIYLFVMAGILWIYHWHATLIVECHDELSLAYFSCG-------WYN 365

  Fly   340 FSPPTKRALLIAAMRAQRPCQMKGYFFEASMATFSTIVRSAVSYIMMLRS 389
            |..|.::.|:...|.||||.:|:....:.::.||..|.|.|.||..:|||
  Fly   366 FEMPLQKMLVFMMMHAQRPMKMRALLVDLNLRTFIDIGRGAYSYFNLLRS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 74/380 (19%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 63/309 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.