DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or49b

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster


Alignment Length:406 Identity:73/406 - (17%)
Similarity:157/406 - (38%) Gaps:75/406 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VQILVYRCMGIDLWSPTMANDRPWLTFVTMGPLFLFMVPMFLAAHEYITQVSLLSDT-------L 76
            :|::......:..|:  :..|:....:|.:|          ||:....||:..:..|       :
  Fly     5 IQLIYMNIKILRFWA--LLYDKNLRRYVCIG----------LASFHIFTQIVYMMSTNEGLTGII 57

  Fly    77 GSTFASML----TLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPD--------AREIIEVENQ 129
            .:::..:|    .|..:||...|.:..        |::.|..|.:.|        ..||::..|:
  Fly    58 RNSYMLVLWINTVLRAYLLLADHDRYL--------ALIQKLTEAYYDLLNLNDSYISEILDQVNK 114

  Fly   130 SDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHL----ELPHNGVYPYDLQVVMFYVPT 190
            ..::::        ...:|..:...:|..|..:...|..|    ::|  |:..|:..   :|...
  Fly   115 VGKLMA--------RGNLFFGMLTSMGFGLYPLSSSERVLPFGSKIP--GLNEYESP---YYEMW 166

  Fly   191 YLWNVMASYSAVTMALCVDSL---LFFFTYNVCAIFKIAKHRM--IHLPAVGG----KEELEGLV 246
            |::.::.:.....|.:...||   |..|....|   |..:||:  :.|....|    :|..|.::
  Fly   167 YIFQMLITPMGCCMYIPYTSLIVGLIMFGIVRC---KALQHRLRQVALKHPYGDRDPRELREEII 228

  Fly   247 QVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYFIAFVGSLL--- 308
            ..:...|..::..|||.:....:...:....:..:|.:.|.:..:....|.:....::..:|   
  Fly   229 ACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLCALLFMLIIVSGTSQLIIVCMYINMILAQI 293

  Fly   309 IALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQ-MKGYFFEASMAT 372
            :||:.|:   ..::..:|......|||.|..|..|.::.:|...||||||.. :.|.....::..
  Fly   294 LALYWYA---NELREQNLAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLEL 355

  Fly   373 FSTIVRSAVSYIMMLR 388
            |..::.:..::..:|:
  Fly   356 FQNLLNTTYTFFTVLK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 64/348 (18%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 62/337 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.