DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or47b

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster


Alignment Length:374 Identity:79/374 - (21%)
Similarity:147/374 - (39%) Gaps:54/374 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WLTFVTMGPLFLFMVPMFLAAHEYITQVSLLSDTLGSTFASMLTLVKFLLFCYHRK--EFVGLI- 103
            |:....|..:......||:|..|....:.:..|.:   :.|.:.||...:|..|.:  |...|| 
  Fly    63 WINLFIMCNVMTIFWTMFVALPESKNVIEMGDDLV---WISGMALVFTKIFYMHLRCDEIDELIS 124

  Fly   104 ---YHIRAI----LAKEIEVWPDAREIIEVENQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSS 161
               |:.|.:    :.:|:..|.....:||         |..|..||.|...|:|     .|.|..
  Fly   125 DFEYYNRELRPHNIDEEVLGWQRLCYVIE---------SGLYINCFCLVNFFSA-----AIFLQP 175

  Fly   162 IRGDEIHLELPHNGVYPY-----DLQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCA 221
            :.|:.   :||.:.|||:     ||....|:. .|:|..:.|...:...|.|| ::...|:...|
  Fly   176 LLGEG---KLPFHSVYPFQWHRLDLHPYTFWF-LYIWQSLTSQHNLMSILMVD-MVGISTFLQTA 235

  Fly   222 I-FKI--AKHRMIHLPAVGGKEELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICF 283
            : .|:  .:.|.:....|..|...|...:|:..||..:::.......:......|...|...|..
  Fly   236 LNLKLLCIEIRKLGDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISI 300

  Fly   284 IGFQ-VADLFPNPQS------LYFIAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETN-WTDF 340
            ..|: :|....:|:.      |..:||     |.|.::...|..:.:.|::.....::.| |...
  Fly   301 STFETMAAAAVDPKMAAKFVLLMLVAF-----IQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTK 360

  Fly   341 SPPTKRALLIAAMRAQRPCQ-MKGYFFEASMATFSTIVRSAVSYIMMLR 388
            ||..:|.:....:|||:|.. :...|...::.|:..::::....:.:::
  Fly   361 SPGIQRDISFVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQ 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 73/339 (22%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 73/340 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.