DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or45b

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:328 Identity:68/328 - (20%)
Similarity:136/328 - (41%) Gaps:35/328 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 SMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREIIEVENQSDQMLSLTYTRC----F 142
            |..||.|.....:.|:|...|:..||.::.:: |...|:|..:     :.:...|..|||    |
  Fly    82 SFTTLFKLGWMWWRRQEVADLMDRIRLLIGEQ-EKREDSRRKV-----AQRSYYLMVTRCGMLVF 140

  Fly   143 GLAGIFAALKPFVGIILSSI------RGDEIHLELPHNGVYPYDLQVVMFYVPT-YLWNVMASYS 200
            .|..|...     ..:|.|:      |..|...::|...:: :|....|.:.|. ||::..:...
  Fly   141 TLGSITTG-----AFVLRSLWEMWVRRHQEFKFDMPFRMLF-HDFAHRMPWFPVFYLYSTWSGQV 199

  Fly   201 AVTMALCVDSLLFFFTYNVCAIFKIAKH------RMIHLPAV-GGKEELEGLVQVLLLHQKGLQI 258
            .|......|...|.||..:..:.:..::      :.|..|:: ..|...:.|..::..|.:..:|
  Fly   200 TVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIRDPSLRESKICCQRLADIVDRHNEIEKI 264

  Fly   259 ADHIADKYRPLIFLQFFLSALQICFIGFQVAD--LFPNPQSLYFIAFVGSLLIALFIYSKCGENI 321
            ....:.......|:.|..::|   .|...|.|  |:.....:.::.:..::..|:|:|...|..:
  Fly   265 VKEFSGIMAAPTFVHFVSASL---VIATSVIDILLYSGYNIIRYVVYTFTVSSAIFLYCYGGTEM 326

  Fly   322 KSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQMKGYFFEASMATFSTIVRSAVSYIMM 386
            .:.||..|...|.:.|..:...|:|.:.:..:|||||..::..||..|:..|:::::...|.:.:
  Fly   327 STESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRVPFFAPSLPVFTSVIKFTGSIVAL 391

  Fly   387 LRS 389
            .::
  Fly   392 AKT 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 67/318 (21%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 67/318 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26277
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.