DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or43a

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster


Alignment Length:405 Identity:77/405 - (19%)
Similarity:158/405 - (39%) Gaps:87/405 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MGIDLWS------PTMANDRPWLTFVTMGPL-------FLFMVPMFLAAHEYITQVSLLSDTLGS 78
            :.:.:|.      ||..:.  |..|..:.|:       |::::.|:.....:|..:...|....:
  Fly    11 INVRMWRHLAVLYPTPGSS--WRKFAFVLPVTAMNLMQFVYLLRMWGDLPAFILNMFFFSAIFNA 73

  Fly    79 TFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREII-EVENQSDQMLSLTYTRCF 142
            ...:.|.::|...|    :||:|.:..:...:....:.|  .|.|: ..|.::         |..
  Fly    74 LMRTWLVIIKRRQF----EEFLGQLATLFHSILDSTDEW--GRGILRRAEREA---------RNL 123

  Fly   143 GLAGIFAALKPFVGIILSSI-RGDEIH---LELP---------HNGVY----PYDLQVVMFYVP- 189
            .:..:.|:....||.::|.: |.:..|   |.||         :..:|    |..|.:.|.|:| 
  Fly   124 AILNLSASFLDIVGALVSPLFREERAHPFGLALPGVSMTSSPVYEVIYLAQLPTPLLLSMMYMPF 188

  Fly   190 TYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPAVGGKEELE-----GLVQVL 249
            ..|:..:|.:..                   |:.:|..||   |..:||:|:.|     .|...:
  Fly   189 VSLFAGLAIFGK-------------------AMLQILVHR---LGQIGGEEQSEEERFQRLASCI 231

  Fly   250 LLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYFIAFVGSLLIALFIY 314
            ..|.:.::....:......::.::..:....||.:.|.:..:....|.:..:.::.::|..||.|
  Fly   232 AYHTQVMRYVWQLNKLVANIVAVEAIIFGSIICSLLFCLNIITSPTQVISIVMYILTMLYVLFTY 296

  Fly   315 SK-----CGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQMK-GYFFEASMATF 373
            ..     |.||.:.|     ..:|...|.:.....::.|||..|:.|.|.::: |..:..::|.|
  Fly   297 YNRANEICLENNRVA-----EAVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMF 356

  Fly   374 STIVRSAVSYIMMLR 388
            .:::.::.||..|||
  Fly   357 QSLLNASYSYFTMLR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 63/342 (18%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 64/349 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.