DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or10a

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:432 Identity:94/432 - (21%)
Similarity:170/432 - (39%) Gaps:88/432 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EKDQSLRVQILVYRCMGIDL---WSPTMANDRPWLTFVTMGPLFLFMVPMFLAAHEYI--TQVSL 71
            ::||.|.|.......:.:|:   |.....:..||.:.:....|.:.:.....|...::  .|::|
  Fly     9 KRDQQLDVYFFAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILAIGVATELHAGMCFLDRQQITL 73

  Fly    72 LSDTLGSTFASMLTLVKFLLFCYHRKEFV-------GLIY----------HIR---AILAKEIEV 116
            ..:||.....|.:||:|..|....|::..       ||::          .||   :.:|..|..
  Fly    74 ALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINF 138

  Fly   117 WPDAREIIEVENQSDQMLSLTYTRC--FGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPY 179
            ||               ||..:..|  :.|..|..|:     |:....|.::.....|.|...|.
  Fly   139 WP---------------LSAGFFTCTTYNLKPILIAM-----ILYLQNRYEDFVWFTPFNMTMPK 183

  Fly   180 DLQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPAVGGKEELEG 244
            .|....|:..||::.....|..:.|....|...|.|..::.|:|::.            :.|:|.
  Fly   184 VLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVL------------QAEIES 236

  Fly   245 L------------VQVLLLHQKG----------LQIADHIADKYRPLIFLQFFLSALQICFIGFQ 287
            :            ||:.:|.||.          :.:.....|:| .:|.|..|:||..:  |||.
  Fly   237 MFRPYTDHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRY-TIITLAHFVSAAMV--IGFS 298

  Fly   288 VADLFP----NPQSLYFIAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRAL 348
            :.:|..    ...::.::|:..:.|..|.:|...|..:..:|......::...|..|.|..:|.:
  Fly   299 MVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLV 363

  Fly   349 LIAAMRAQRPCQMKGYFFEASMATFSTIVRSAVSYIMMLRSF 390
            .:..:|:|||..|...||..|:|||:.|::::.|.|.:::||
  Fly   364 QLLILRSQRPVSMAVPFFSPSLATFAAILQTSGSIIALVKSF 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 80/360 (22%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 80/360 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26277
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.