DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or82a

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:326 Identity:90/326 - (27%)
Similarity:160/326 - (49%) Gaps:19/326 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREIIEVENQSDQMLSL---T 137
            |...|.:|||::|...|..:||:|..:|:..|.:..:.....|..||.::...:::::.|.   .
  Fly    65 LSVVFTNMLTVIKISTFLANRKDFWEMIHRFRKMHEQSASHIPRYREGLDYVAEANKLASFLGRA 129

  Fly   138 YTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPY-DLQVVMFYVPTYLWNVMASYSA 201
            |....||.|::..|.|.|.|.:....|.....|||....:|: ||:...:.| .:|:.|:.:...
  Fly   130 YCVSCGLTGLYFMLGPIVKIGVCRWHGTTCDKELPMPMKFPFNDLESPGYEV-CFLYTVLVTVVV 193

  Fly   202 VTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPAVGGKEELE-GLVQVLLLHQKGLQIADHIADK 265
            |..|..||.|...|..|:.|.|:..:.::.:......:.:.: .|..::..|...|.::..:...
  Fly   194 VAYASAVDGLFISFAINLRAHFQTLQRQIENWEFPSSEPDTQIRLKSIVEYHVLLLSLSRKLRSI 258

  Fly   266 YRPLIFLQFFLSALQICFIGFQ-------VADLFPNPQSLYFIAFVGSLLIALFIYSKCGENIKS 323
            |.|.:..||.:::||:..|.:|       |.||      |.:.:|.||:::.||||...||.||:
  Fly   259 YTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDL------LLYASFFGSIMLQLFIYCYGGEIIKA 317

  Fly   324 ASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQMKGYFFEASMATFSTIVRSAVSYIMMLR 388
            .||.....:..:||...||.|:.:|.:..:::|:...::..||.||:|.|..|.|:|:|.|.:::
  Fly   318 ESLQVDTAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRAGFFVASLANFVGICRTALSLITLIK 382

  Fly   389 S 389
            |
  Fly   383 S 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 86/316 (27%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 86/315 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H62715
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009998
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.