DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or69a

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:361 Identity:74/361 - (20%)
Similarity:132/361 - (36%) Gaps:78/361 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREIIEVENQ 129
            |:.:::.::..||.|....|.|.|.|          .|..|...:|                 |:
  Fly    73 YLAELASVASMLGFTIVGTLNLWKML----------SLKTHFENLL-----------------NE 110

  Fly   130 SDQMLSL-------------TYTRCFGLAGIF--AALKPFVGI-ILSSIR-----GDEIHLELPH 173
            .:::..|             .|||......||  :|:..:..: ||..||     ..::...:..
  Fly   111 FEELFQLIKHRAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQLGYRIQS 175

  Fly   174 NGVYPYDLQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPAVG- 237
            |..||:.:|   ..:|.:...|.....:....:||:..:.|    :...|.|...  ||...:. 
  Fly   176 NTWYPWQVQ---GSIPGFFAAVACQIFSCQTNMCVNMFIQF----LINFFGIQLE--IHFDGLAR 231

  Fly   238 -----------GKEELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADL 291
                       .|::|:.|:   :.|.|.|.:||.:...:.....:...:|.:..||:.|.:. :
  Fly   232 QLETIDARNPHAKDQLKYLI---VYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMT-M 292

  Fly   292 FPNPQSLYFIAFVGSLLIALFIYSKC--GENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMR 354
            |....||..:  :|.||...:.:|.|  |.::...|.......:..||.:.....:|.|||..||
  Fly   293 FDFGTSLKHL--LGLLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMR 355

  Fly   355 AQRPCQMKGY-FFEASMATFSTIVRSAVSYIMMLRS 389
            |.:|...|.| ....|:.|:...::.:......:||
  Fly   356 ATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 71/348 (20%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 71/350 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.