DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and YPT1

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_116615.1 Gene:YPT1 / 850505 SGDID:S000001856 Length:206 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:76/167 - (45%)
Similarity:109/167 - (65%) Gaps:0/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHFDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGD 66
            |.:|||||:|::|:|||||||||:|||||.:|..|:.|:|:|.|.::|||..:.:.||:|||:|.
Yeast     3 SEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

  Fly    67 KRFNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVS 131
            :||.::..|.||.:|||::|||:|..:||..:..|::||.|.....|..||||||.|..:.|.|.
Yeast    68 ERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVE 132

  Fly   132 MEQGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDI 168
            .:....:|....:.|.|.||....||.|.|.::|..|
Yeast   133 YDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 72/161 (45%)
Rab 8..165 CDD:206640 70/156 (45%)
YPT1NP_116615.1 Rab1_Ypt1 7..172 CDD:206661 74/163 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.