DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and ATFP8

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_187779.1 Gene:ATFP8 / 820345 AraportID:AT3G11730 Length:205 Species:Arabidopsis thaliana


Alignment Length:167 Identity:75/167 - (44%)
Similarity:110/167 - (65%) Gaps:0/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHFDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGD 66
            :.:|||||:|::|||.|||||||:||:||.:.:.|:.|:|:|.|.|::|...:.:.||:|||:|.
plant     3 NEYDYLFKLLLIGDSSVGKSCLLLRFADDAYIDSYISTIGVDFKIRTIEQDGKTIKLQIWDTAGQ 67

  Fly    67 KRFNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVS 131
            :||.::..|.||.||||::|||.|..:||.|:..|:.||.|...:.|..||:|||:|....:.||
plant    68 ERFRTITSSYYRGAHGIIIVYDCTEMESFNNVKQWLSEIDRYANESVCKLLIGNKNDMVESKVVS 132

  Fly   132 MEQGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDI 168
            .|.|...|....:.|.|.|||..:||...|.::|.:|
plant   133 TETGRALADELGIPFLETSAKDSINVEQAFLTIAGEI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 72/161 (45%)
Rab 8..165 CDD:206640 70/156 (45%)
ATFP8NP_187779.1 Rab1_Ypt1 7..172 CDD:206661 74/163 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.