DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and rab33a

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001038893.1 Gene:rab33a / 751718 ZFINID:ZDB-GENE-060825-283 Length:236 Species:Danio rerio


Alignment Length:168 Identity:63/168 - (37%)
Similarity:92/168 - (54%) Gaps:13/168 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKRF-N 70
            :||::|:|||.|||:||..||:...|..|...|:|:|.:.::||:....:.:|||||:|.:|| .
Zfish    38 IFKIIVIGDSNVGKTCLTFRFTGGAFPCKTEATIGVDFREKAVEIEGEKIKVQVWDTAGQERFRK 102

  Fly    71 SLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMC-----PDKVTVLLVGNKSDDPNHRQV 130
            |::...||:.|.::.|||:|...||||:..|::|    |     ...|..:|||||.|..:..||
Zfish   103 SMVEHYYRNVHAVVFVYDVTKMASFQNLKTWIQE----CNGHGVSSAVPRVLVGNKCDLVDQIQV 163

  Fly   131 SMEQGFNYAHRGALGFEEVSA---KSGMNVYDIFSSLA 165
            .......:|....:...|.||   |...||..||..||
Zfish   164 PSNTALKFADAYNMLLFETSAKDPKESQNVDSIFMCLA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 63/167 (38%)
Rab 8..165 CDD:206640 61/165 (37%)
rab33aNP_001038893.1 Rab33B_Rab33A 37..206 CDD:133315 63/168 (38%)
RAB 39..207 CDD:197555 63/167 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.