DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and RAB5B

DIOPT Version :10

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001401387.1 Gene:RAB5B / 5869 HGNCID:9784 Length:296 Species:Homo sapiens


Alignment Length:158 Identity:63/158 - (39%)
Similarity:96/158 - (60%) Gaps:0/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKRFNSL 72
            ||:::||:|.||||.|::||...:|.|....|:|.....:||.|....:..::|||:|.:|::||
Human   102 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSL 166

  Fly    73 MPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQGFN 137
            .|..||.|...::|||||:.::|.....|:||::|.....:.:.|.|||:|..|.|.|..|:...
Human   167 APMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQA 231

  Fly   138 YAHRGALGFEEVSAKSGMNVYDIFSSLA 165
            ||...:|.|.|.|||:.|||.|:|.::|
Human   232 YADDNSLLFMETSAKTAMNVNDLFLAIA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 Rab 8..165 CDD:206640 62/156 (40%)
RAB5BNP_001401387.1 Rab5_related 101..263 CDD:206653 63/158 (40%)

Return to query results.
Submit another query.