DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and LOC555645

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_009295987.1 Gene:LOC555645 / 555645 -ID:- Length:280 Species:Danio rerio


Alignment Length:204 Identity:67/204 - (32%)
Similarity:112/204 - (54%) Gaps:16/204 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKRF 69
            |:|||::::|||.|||:|::..|.....||....|:|:|...||:::..|.:.:|||||:|.:||
Zfish    76 DFLFKIILIGDSNVGKTCVIQSFRSAEVTELQHNTIGVDFTVRSMDVDGRRVKMQVWDTAGQERF 140

  Fly    70 NSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQ 134
            .::..|.||||||.::.||::...:|.::..|::.:.:.....:.::|:|||.|....|||..|.
Zfish   141 RTITQSYYRSAHGAMIAYDLSRRDTFDSLPHWIQALEQYGAASLVLVLIGNKCDLEAQRQVLFED 205

  Fly   135 GFNYAHR-GALGFEEVSAKSGMNVYDIFSSLAMDIYHRY---------------VLHNPISPMPS 183
            ....|.| |||...|.|||...|:.:.|..:|.::..|:               .||:...|:..
Zfish   206 ACTLAERSGALAALETSAKHHHNIEEAFQLMARELLVRHGGIHYQDNQSDSPTVYLHSDSHPIEG 270

  Fly   184 EQEEEDAAE 192
            ||.|:.:.:
Zfish   271 EQLEKRSCD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 58/163 (36%)
Rab 8..165 CDD:206640 57/157 (36%)
LOC555645XP_009295987.1 P-loop_NTPase 76..240 CDD:304359 60/163 (37%)
RAB 79..241 CDD:197555 58/161 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.