DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and rab19

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001017246.1 Gene:rab19 / 550000 XenbaseID:XB-GENE-495128 Length:213 Species:Xenopus tropicalis


Alignment Length:197 Identity:68/197 - (34%)
Similarity:112/197 - (56%) Gaps:5/197 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKR 68
            ||:|||::::|||.|||:|::.||....|......|:|:|...|::.:..:.:.:|||||:|.:|
 Frog    12 FDFLFKIILIGDSNVGKTCVVHRFQSGVFAHNQQNTIGVDFTVRNMNINGKKVKVQVWDTAGQER 76

  Fly    69 FNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSME 133
            |.::..|.||||||.::.||||..:||:::..|:.|..:.....:.::|:|||||....||:..|
 Frog    77 FRTITQSYYRSAHGAIIAYDITRRQSFESVPHWIYEAEKYGAANLMMMLIGNKSDLAEKRQILFE 141

  Fly   134 QGFNYAHR-GALGFEEVSAKSGMNVYDIFSSLAMDIYHRYVLH----NPISPMPSEQEEEDAAES 193
            :....|.: |.|...|.|||...||.::|..:|.::..|...|    :|.:....:.:...|...
 Frog   142 EACTLAEKHGLLAVLETSAKESHNVDEVFLLMAKELIARNTFHYHSESPRNSFMLDSKPVLAPPE 206

  Fly   194 PD 195
            ||
 Frog   207 PD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 59/163 (36%)
Rab 8..165 CDD:206640 58/157 (37%)
rab19NP_001017246.1 Rab19 13..177 CDD:133267 61/163 (37%)
Effector region. /evidence=ECO:0000250 44..52 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.