DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and cplane2

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001016685.1 Gene:cplane2 / 549439 XenbaseID:XB-GENE-5914875 Length:255 Species:Xenopus tropicalis


Alignment Length:138 Identity:32/138 - (23%)
Similarity:58/138 - (42%) Gaps:21/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDV-----------KARSVELVSRVMMLQVW 61
            :|:.|.|.||.||:..:.:.:.......:..|.||..           .||.|     :...|.|
 Frog    58 YKLFVCGRSGAGKTSFIAKLAGLEVPSMHHETTGIQTTCVYWPVRPTHSARPV-----IFRFQFW 117

  Fly    62 DTSGD---KRFNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSD 123
            | .|:   ::|:.::|:....|..:|.::..|...||:::...:........| |..:::|||.|
 Frog   118 D-CGEGALRKFDHILPACKEMADAVLFLFSFTDRSSFEDVPALISRTLGQEED-VARVVIGNKLD 180

  Fly   124 DPNHRQVS 131
            ...|..|:
 Frog   181 QYTHTDVT 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 32/138 (23%)
Rab 8..165 CDD:206640 32/138 (23%)
cplane2NP_001016685.1 Small GTPase-like 52..255 32/138 (23%)
small_GTP 58..229 CDD:272973 32/138 (23%)
Ras_like_GTPase 62..195 CDD:206648 31/134 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.