Sequence 1: | NP_572627.1 | Gene: | RabX2 / 31971 | FlyBaseID: | FBgn0030200 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007418.1 | Gene: | zgc:101559 / 492776 | ZFINID: | ZDB-GENE-041114-122 | Length: | 233 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 68/203 - (33%) |
---|---|---|---|
Similarity: | 107/203 - (52%) | Gaps: | 31/203 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 LFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKRF-N 70
Fly 71 SLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEI-RRMCPDKVTVLLVGNKSDDPNHRQVS--- 131
Fly 132 ---MEQGFNYAHRGALGFEEVSAK---SGMNVYDIFSSLAMDIYHRYVLHNPIS----------P 180
Fly 181 MPSEQEEE 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX2 | NP_572627.1 | RAB | 8..171 | CDD:197555 | 61/173 (35%) |
Rab | 8..165 | CDD:206640 | 59/167 (35%) | ||
zgc:101559 | NP_001007418.1 | Rab33B_Rab33A | 35..204 | CDD:133315 | 62/177 (35%) |
RAB | 37..204 | CDD:197555 | 62/176 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0084 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |