Sequence 1: | NP_572627.1 | Gene: | RabX2 / 31971 | FlyBaseID: | FBgn0030200 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001004649.1 | Gene: | cplane2 / 447911 | ZFINID: | ZDB-GENE-040912-80 | Length: | 252 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 51/199 - (25%) |
---|---|---|---|
Similarity: | 88/199 - (44%) | Gaps: | 17/199 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDV-----KARSVELVSRVMM--LQVWD--T 63
Fly 64 SGDKRFNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHR 128
Fly 129 QVSMEQGFNYAHRGALGF----EEVSAKSGMNVYDIFSSLAMDIYHR-YVLHNPISPMPSEQEEE 188
Fly 189 DAAE 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX2 | NP_572627.1 | RAB | 8..171 | CDD:197555 | 46/175 (26%) |
Rab | 8..165 | CDD:206640 | 44/169 (26%) | ||
cplane2 | NP_001004649.1 | Small GTPase-like | 46..252 | 51/199 (26%) | |
Gem1 | 52..>194 | CDD:224025 | 38/141 (27%) | ||
P-loop_NTPase | 54..>184 | CDD:304359 | 37/131 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |