DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and RAB8A

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_005361.2 Gene:RAB8A / 4218 HGNCID:7007 Length:207 Species:Homo sapiens


Alignment Length:165 Identity:78/165 - (47%)
Similarity:112/165 - (67%) Gaps:0/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKR 68
            :|||||:|::|||||||:|:|.|||:|.|...::.|:|||.|.|::||..:.:.||:|||:|.:|
Human     5 YDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQER 69

  Fly    69 FNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSME 133
            |.::..:.||.|.||:||||||:.|||.||..|::.|.......|..:::|||.|..:.||||.|
Human    70 FRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKE 134

  Fly   134 QGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDI 168
            :|...|....:.|.|.|||:.:||.:.|.:||.||
Human   135 RGEKLALDYGIKFMETSAKANINVENAFFTLARDI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 75/161 (47%)
Rab 8..165 CDD:206640 71/156 (46%)
RAB8ANP_005361.2 Rab8_Rab10_Rab13_like 6..172 CDD:206659 78/164 (48%)
Effector region. /evidence=ECO:0000250 37..45 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.