DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and rab35l

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_989002.1 Gene:rab35l / 394598 XenbaseID:XB-GENE-5809894 Length:201 Species:Xenopus tropicalis


Alignment Length:185 Identity:78/185 - (42%)
Similarity:117/185 - (63%) Gaps:10/185 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKR 68
            :|:|||:|::||||||||.||:||||:.|:..|:.|:|:|.|.|::.|....:.||:|||:|.:|
 Frog     6 YDHLFKLLLIGDSGVGKSSLLLRFSDNSFSGSYITTIGVDFKIRTLVLDGERVKLQIWDTAGQER 70

  Fly    69 FNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSME 133
            |.::..:.||:.||:::|||:||.:||.|:..|:.||.:.| |.|..:|||||.|||:.::|...
 Frog    71 FRTITSTYYRNTHGVIVVYDVTSPESFVNVKRWLHEITQNC-DSVCTVLVGNKDDDPSRKRVEAA 134

  Fly   134 QGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIYHRYVLH----NPISPMPSE 184
            ....:|.:..:...|.|||...||.::|.|:.     |.||.    |.....|||
 Frog   135 DAKRFADQMGVRMFETSAKENRNVEEMFLSVT-----RMVLRMKKDNQARLNPSE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 69/162 (43%)
Rab 8..165 CDD:206640 69/156 (44%)
rab35lNP_989002.1 P-loop_NTPase 4..201 CDD:393306 78/185 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.