DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and Rabl6

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001102043.1 Gene:Rabl6 / 362084 RGDID:1307615 Length:731 Species:Rattus norvegicus


Alignment Length:149 Identity:37/149 - (24%)
Similarity:69/149 - (46%) Gaps:28/149 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKA--RSVELVSRVMMLQVWDT----S 64
            |..|:::.||...||:.|..|....:|.|:|:.|..|.|.:  .:.:....|:.::|||.    .
  Rat    42 YNMKIVIRGDRNTGKTALWHRLQGKKFVEEYIPTQEIQVTSIHWNYKTTDDVVKVEVWDVVDKGK 106

  Fly    65 GDKRFNSLMPSN------------------YRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPD 111
            ..||.:.|...|                  |::.:|:::::|||...:|..:   ::|:.:: |.
  Rat   107 CKKRGDCLKTENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYV---LRELPKV-PT 167

  Fly   112 KVTVLLVGNKSDDPNHRQV 130
            .|.|.::||..|...||.:
  Rat   168 HVPVCVLGNYRDMGEHRVI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 36/147 (24%)
Rab 8..165 CDD:206640 36/147 (24%)
Rabl6NP_001102043.1 P-loop_NTPase 44..221 CDD:304359 36/147 (24%)
Ras 45..221 CDD:278499 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.