DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and Rab14

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster


Alignment Length:199 Identity:67/199 - (33%)
Similarity:108/199 - (54%) Gaps:13/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HFDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDK 67
            :::|:||.:::||.||||||||.:|::.:|......|:|::...|.:|:..:.:.||:|||:|.:
  Fly    31 NYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQE 95

  Fly    68 RFNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSM 132
            ||.::..|.||.|.|.|:|||||...::.::..|:.:.|.:......:.|:|||||..:.|:|:.
  Fly    96 RFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTY 160

  Fly   133 EQGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIYHRY-------------VLHNPISPMPSE 184
            |:...:|....|.|.|.||.:|.||.:.|...|..||...             |.|.|..|..:.
  Fly   161 EEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTS 225

  Fly   185 QEEE 188
            ...|
  Fly   226 LSSE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 61/162 (38%)
Rab 8..165 CDD:206640 58/156 (37%)
Rab14NP_788056.1 Rab14 34..199 CDD:133322 62/164 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454286
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.