DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and RAB43

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001191812.1 Gene:RAB43 / 339122 HGNCID:19983 Length:212 Species:Homo sapiens


Alignment Length:193 Identity:69/193 - (35%)
Similarity:116/193 - (60%) Gaps:13/193 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKR 68
            :|:|||::::||:.|||:|::.||....|:|:...|:|:|...:::|:..:.:.||:|||:|.:|
Human    15 YDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQER 79

  Fly    69 FNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSME 133
            |.::..|.||||:|.:|.||||...||.::..|::::|:.....:..||:|||||....|:||:.
Human    80 FRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLA 144

  Fly   134 QGFNYA-HRGALGFEEVSAKSGMNVYDIFSSLAMDIYHRYVLHNPISPMPSEQEEEDAAESPD 195
            :..:.| |...|...|.|||...||.:.|..:|.::..|:.     .|:.||       :|||
Human   145 EAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHG-----GPLFSE-------KSPD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 60/163 (37%)
Rab 8..165 CDD:206640 59/157 (38%)
RAB43NP_001191812.1 Rab19 16..180 CDD:133267 62/163 (38%)
Effector region. /evidence=ECO:0000250 47..55 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.