DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and Rab9Fa

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_727471.1 Gene:Rab9Fa / 326230 FlyBaseID:FBgn0052671 Length:197 Species:Drosophila melanogaster


Alignment Length:198 Identity:143/198 - (72%)
Similarity:162/198 - (81%) Gaps:4/198 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHFDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVM--MLQVWDT 63
            ||.:|..||:::||||||||:||||||||::||.::..|:|:|.:..|||.....|  |||||||
  Fly     1 MSQYDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDT 65

  Fly    64 SGDKRFNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHR 128
            |.|:||..|..:..||||||||||||||||||||||||||||||:||||||||||||||||||||
  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHR 130

  Fly   129 QVSMEQGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIY-HRYVLHNPISPMPSEQEEEDAAE 192
            ||||.||||||||.::.|||||||||.|||||||||||||| :|.|..||.| :.|.||||||||
  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHCNPFS-LTSWQEEEDAAE 194

  Fly   193 SPD 195
            |.|
  Fly   195 SLD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 124/165 (75%)
Rab 8..165 CDD:206640 118/158 (75%)
Rab9FaNP_727471.1 RAB 8..171 CDD:197555 122/162 (75%)
Rab 8..167 CDD:206640 118/158 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464162
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009971
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.