DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and Rab9D

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster


Alignment Length:198 Identity:142/198 - (71%)
Similarity:162/198 - (81%) Gaps:4/198 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHFDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVM--MLQVWDT 63
            ||.:|..||:::||||||||:||||||||::||.::..|:|:|.:..|||.....|  |||||||
  Fly     1 MSQYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDT 65

  Fly    64 SGDKRFNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHR 128
            |.|:||..|..:..||||||||||||||||||||||||||||||:|||||.||||||||||||||
  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHR 130

  Fly   129 QVSMEQGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIY-HRYVLHNPISPMPSEQEEEDAAE 192
            ||||.||||||||.::.|||||||||.|||||||||||||| :|.|.:||.| :.|.||||||||
  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYTYRRVHYNPFS-LTSWQEEEDAAE 194

  Fly   193 SPD 195
            |.|
  Fly   195 SLD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 123/165 (75%)
Rab 8..165 CDD:206640 117/158 (74%)
Rab9DNP_727432.1 RAB 8..171 CDD:197555 121/162 (75%)
Rab 8..167 CDD:206640 117/158 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0009971
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.