DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and rab-10

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_491857.1 Gene:rab-10 / 266836 WormBaseID:WBGene00004273 Length:201 Species:Caenorhabditis elegans


Alignment Length:185 Identity:78/185 - (42%)
Similarity:116/185 - (62%) Gaps:9/185 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKR 68
            :|.|||:|::|||||||:|:|.|||||.|...::.|:|||.|.:::||..:.:.||:|||:|.:|
 Worm     6 YDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQER 70

  Fly    69 FNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSME 133
            |:::..|.||.|.||:||||||::|||.||..|::.|.....:.|..:::|||.|..:.|.||.|
 Worm    71 FHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRE 135

  Fly   134 QGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIYHRYVLHNPISPMPSEQEEE 188
            :|...|....:.|.|.|||..::|...|..||..|         ::.||...:|:
 Worm   136 RGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAI---------LAKMPDSTDEQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 73/162 (45%)
Rab 8..165 CDD:206640 70/156 (45%)
rab-10NP_491857.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 75/174 (43%)
RAB 10..173 CDD:197555 73/171 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.