DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and ryh1

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_593249.1 Gene:ryh1 / 2543529 PomBaseID:SPAC4C5.02c Length:201 Species:Schizosaccharomyces pombe


Alignment Length:185 Identity:69/185 - (37%)
Similarity:109/185 - (58%) Gaps:6/185 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKRFNSL 72
            ||::.||:..|||:.|:.||..|:|...|..|:|||..::::.|..|.:.||:|||:|.:||.||
pombe    12 FKLVFLGEQSVGKTSLITRFMYDQFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSL 76

  Fly    73 MPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQGFN 137
            :||..|.:...::|||||:..||.|.:.|::::|....|.|.::|||||:|..:.|||:.|:|..
pombe    77 IPSYIRDSSVAIIVYDITNHNSFVNTEKWIEDVRAERGDDVIIVLVGNKTDLADKRQVTQEEGEK 141

  Fly   138 YAHRGALGFEEVSAKSGMNVYDIFSSLAM------DIYHRYVLHNPISPMPSEQE 186
            .|....:...|.|||:|.||..:|..:|.      ::..:......:|..|:|.|
pombe   142 KAKELKIMHMETSAKAGHNVKLLFRKIAQMLPGMENVETQSTQMIDVSIQPNENE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 65/168 (39%)
Rab 8..165 CDD:206640 64/156 (41%)
ryh1NP_593249.1 Rab6 12..172 CDD:206654 65/159 (41%)
RAB 12..170 CDD:197555 64/157 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.