DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and Rab33a

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_036017751.1 Gene:Rab33a / 19337 MGIID:109493 Length:258 Species:Mus musculus


Alignment Length:113 Identity:42/113 - (37%)
Similarity:57/113 - (50%) Gaps:5/113 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LQVWDTSGDKRF-NSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIR-RMCPDKVTVLLVGN 120
            :|||||:|.:|| .|::...||:.|.::.|||:|...||.|:..|::|.. ...|..|..:||||
Mouse   108 VQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGN 172

  Fly   121 KSDDPNHRQVSMEQGFNYAHRGALGFEEVSA---KSGMNVYDIFSSLA 165
            |.|.....||.......:|....:...|.||   |...||..||..||
Mouse   173 KCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 42/113 (37%)
Rab 8..165 CDD:206640 40/111 (36%)
Rab33aXP_036017751.1 P-loop_NTPase <108..225 CDD:422963 42/113 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.