Sequence 1: | NP_572627.1 | Gene: | RabX2 / 31971 | FlyBaseID: | FBgn0030200 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_077768.3 | Gene: | Rab12 / 19328 | MGIID: | 894284 | Length: | 291 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 80/196 - (40%) |
---|---|---|---|
Similarity: | 118/196 - (60%) | Gaps: | 6/196 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 DYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKRF 69
Fly 70 NSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQ 134
Fly 135 GFNYAHR-GALGFEEVSAKSGMNVYDIFSSLAMDIYHRY---VLHNPISP--MPSEQEEEDAAES 193
Fly 194 P 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX2 | NP_572627.1 | RAB | 8..171 | CDD:197555 | 71/163 (44%) |
Rab | 8..165 | CDD:206640 | 68/157 (43%) | ||
Rab12 | NP_077768.3 | Rab12 | 90..291 | CDD:206699 | 79/193 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1149105at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |