DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and F08G12.1

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_509888.1 Gene:F08G12.1 / 181320 WormBaseID:WBGene00008585 Length:635 Species:Caenorhabditis elegans


Alignment Length:171 Identity:48/171 - (28%)
Similarity:81/171 - (47%) Gaps:40/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDV-----KARSVELVSRVMMLQVWDTSG 65
            |..|:::.||..|||:||..|.....|.|:|:.|..|.|     ..|:.:.|.:|.:..:.|.|.
 Worm    42 YNLKIVIRGDRNVGKTCLWKRLQGLSFQEEYVATEEIQVANINWNYRATDDVVKVDVWDIVDQST 106

  Fly    66 DKRF--------NSLMPSN-----------------YRSAHGILLVYDITSSKSFQNIDGWMKEI 105
            .||.        |:.|..|                 |:..:|::.|:|||.:.:::.:   .|||
 Worm   107 KKRVKDDKLKLANNGMDKNDGLDYEDTACDARFVDVYKGTNGVIFVFDITKTWTWEYV---QKEI 168

  Fly   106 RRMCPDKVTVLLVGNKSDDPNHRQV------SMEQGFNYAH 140
            .:: |:|:.||::.|:.|..:||||      :..:.||.:|
 Worm   169 VKV-PNKIPVLVLANRRDMGHHRQVTDLQCSTFVELFNSSH 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 47/169 (28%)
Rab 8..165 CDD:206640 47/169 (28%)
F08G12.1NP_509888.1 P-loop_NTPase 44..>193 CDD:304359 43/152 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.