DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and rab-1

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_503397.1 Gene:rab-1 / 178620 WormBaseID:WBGene00004266 Length:205 Species:Caenorhabditis elegans


Alignment Length:168 Identity:81/168 - (48%)
Similarity:115/168 - (68%) Gaps:0/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKR 68
            :|||||:|::|||||||||||:||:||.:||.|:.|:|:|.|.|::||..:.:.||:|||:|.:|
 Worm     8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQER 72

  Fly    69 FNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSME 133
            |.::..|.||.||||::|||||..::|.|:..|::||.|...:.|..||||||.|....|.|..:
 Worm    73 FRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACENVNKLLVGNKCDLTAKRAVETQ 137

  Fly   134 QGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIYHR 171
            ...:||.:..:.|.|.||||..||...|.::|.:|..|
 Worm   138 AAQDYAGQLGIPFLETSAKSSTNVEQAFLTMASEIKSR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 77/162 (48%)
Rab 8..165 CDD:206640 75/156 (48%)
rab-1NP_503397.1 Rab1_Ypt1 10..175 CDD:206661 79/164 (48%)
RAB 12..175 CDD:197555 77/162 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.