DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and rab-19

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001370091.1 Gene:rab-19 / 178301 WormBaseID:WBGene00004278 Length:210 Species:Caenorhabditis elegans


Alignment Length:170 Identity:61/170 - (35%)
Similarity:100/170 - (58%) Gaps:1/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKR 68
            ||||||::::||.||||:|::.||.:..|.::...|:|:|...:::.:..:.:.||:|||.|.:|
 Worm     7 FDYLFKIVLVGDMGVGKTCVVQRFRNGTFVDRQGTTIGVDFTMKTLVVDGKRVKLQIWDTGGQER 71

  Fly    69 FNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSME 133
            |.::..|.||||:||:|.||||..:||.::..|:.::.:.....|..||:|.|.|..:.|.:..|
 Worm    72 FRTITQSYYRSANGIVLCYDITCKQSFGSLQRWIDDVSKFAAPNVVKLLIGTKCDLEDQRAIEAE 136

  Fly   134 QG-FNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIYHRY 172
            :. ......|.....|.|||..:||.:.|..||..:..:|
 Worm   137 EAEMLQRANGMFAMLETSAKGNVNVDNAFLELATILKRQY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 56/163 (34%)
Rab 8..165 CDD:206640 54/157 (34%)
rab-19NP_001370091.1 Rab19 8..172 CDD:133267 59/163 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.