DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and rab-30

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_499328.1 Gene:rab-30 / 176476 WormBaseID:WBGene00004282 Length:216 Species:Caenorhabditis elegans


Alignment Length:173 Identity:64/173 - (36%)
Similarity:98/173 - (56%) Gaps:15/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHFDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSG 65
            |..:.|||||:::|::||||:||:.:|:...|......|:|:|...::|::.:..:.||:|||:|
 Worm     1 MEDYKYLFKVVLVGNAGVGKTCLVRKFTQGIFPPGQSATIGVDFMIKTVKVGNDKIKLQIWDTAG 65

  Fly    66 DKRFNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQV 130
            .:||.|:..|.|||||.|:||||::...||..:..|:.||......:|..:|||||.|..:.|:|
 Worm    66 QERFRSITQSYYRSAHAIVLVYDVSCQPSFDCLPEWLGEIESYANRRVLKILVGNKVDKGDEREV 130

  Fly   131 SMEQG--------FNYAHRGALGFEEVSAKSGMNVYDIFSSLA 165
            ....|        |:|       |.|.||....||..:|..:|
 Worm   131 PERIGRDFSDVNQFDY-------FLETSALDATNVDQLFEQVA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 61/166 (37%)
Rab 8..165 CDD:206640 60/164 (37%)
rab-30NP_499328.1 P-loop_NTPase 1..170 CDD:304359 64/173 (37%)
RAB 8..169 CDD:197555 61/166 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.