Sequence 1: | NP_572627.1 | Gene: | RabX2 / 31971 | FlyBaseID: | FBgn0030200 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598811.3 | Gene: | Rab15 / 104886 | MGIID: | 1916865 | Length: | 212 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 73/199 - (36%) |
---|---|---|---|
Similarity: | 120/199 - (60%) | Gaps: | 8/199 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKR 68
Fly 69 FNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSME 133
Fly 134 QGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIY--HRYVLHNPISPMPSE------QEEEDA 190
Fly 191 AESP 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX2 | NP_572627.1 | RAB | 8..171 | CDD:197555 | 63/164 (38%) |
Rab | 8..165 | CDD:206640 | 62/156 (40%) | ||
Rab15 | NP_598811.3 | Rab15 | 9..172 | CDD:206698 | 63/162 (39%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 192..212 | 4/12 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1149105at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |