DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and zgc:171927

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001096112.1 Gene:zgc:171927 / 100124616 ZFINID:ZDB-GENE-070822-21 Length:210 Species:Danio rerio


Alignment Length:168 Identity:76/168 - (45%)
Similarity:113/168 - (67%) Gaps:0/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKR 68
            :|||||:|::|||||||||||:||:||.:||.|:.|:|:|.|.|::|:..:.:.||:|||:|.:|
Zfish     5 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIEMEGKTVKLQIWDTAGQER 69

  Fly    69 FNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSME 133
            |.::..|.||.||||::|||:|..:||.|:..|::||.|...:.|:.||||||||..:.:.|...
Zfish    70 FRTITSSYYRGAHGIIIVYDVTEQESFNNVKQWLEEIDRYACENVSKLLVGNKSDLSSKKVVDFT 134

  Fly   134 QGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIYHR 171
            ....:.....:...|.|||:..||...|.::|.:|..|
Zfish   135 TAMEFTESLKIPLLETSAKNANNVEKAFLAMASEIQKR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 72/162 (44%)
Rab 8..165 CDD:206640 70/156 (45%)
zgc:171927NP_001096112.1 Rab1_Ypt1 7..172 CDD:206661 74/164 (45%)
RAB 9..172 CDD:197555 72/162 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.