DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX2 and si:dkey-16l2.16

DIOPT Version :9

Sequence 1:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_001339327.1 Gene:si:dkey-16l2.16 / 100003902 ZFINID:ZDB-GENE-141219-36 Length:209 Species:Danio rerio


Alignment Length:185 Identity:72/185 - (38%)
Similarity:116/185 - (62%) Gaps:5/185 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKR 68
            :.:|||:|::|||.||||.||:||:|:.|:..|:.|:|:|.|.|:||:....:.||:|||:|.:|
Zfish     6 YHHLFKLLIIGDSNVGKSSLLLRFADNSFSGSYITTIGVDFKIRTVEIDGERVKLQIWDTAGQER 70

  Fly    69 FNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSME 133
            |.::..:.||:.||:::|||:|:.:||.|:..|:.||.:.| |.|..:|||||:|||:.:.|..:
Zfish    71 FRTITSTYYRNTHGVIIVYDVTNPESFVNVKRWLNEISQNC-DNVCKILVGNKNDDPSKKLVDTQ 134

  Fly   134 QGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIYHRYVLHNPISPMPSEQEEE 188
            ....:.....:...|.|||..:||.::|    |...|..:.....|...:|:|.|
Zfish   135 DAMRFGESVGVRLFETSAKENINVEEMF----MAFTHMVLRAKKQSQSRAERERE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX2NP_572627.1 RAB 8..171 CDD:197555 66/162 (41%)
Rab 8..165 CDD:206640 65/156 (42%)
si:dkey-16l2.16XP_001339327.1 P-loop_NTPase 4..209 CDD:328724 72/185 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.