DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32683 and arr3b

DIOPT Version :9

Sequence 1:NP_001285084.1 Gene:CG32683 / 31970 FlyBaseID:FBgn0052683 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_957086.1 Gene:arr3b / 796867 ZFINID:ZDB-GENE-030616-74 Length:362 Species:Danio rerio


Alignment Length:565 Identity:116/565 - (20%)
Similarity:197/565 - (34%) Gaps:222/565 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RVYKKTSPNCVLTLYLPTREITLTGNNPSVLRGIVYVDPKAIQGYRVYAQLTLTFRYGREDEEVM 167
            :||||||.|..|.|||..|:......:...:.|::.:||..:.|.:|:.||...|||||||.:|:
Zfish     3 KVYKKTSGNGSLCLYLGRRDFVDHVESVDSVDGVLKIDPSGLNGRKVWVQLACAFRYGREDLDVI 67

  Fly   168 GLRFCNEAIMSLHQIWPRLEEPTPESLSPLQEALMKRLGDGAHPFTLSLSSYAPPSVQLVPAKRY 232
            |:.|..:..:...|::|  .|.|....:|:||||:|:.||..||||..:..:.|.||.|.||...
Zfish    68 GVSFRKDIWIKRIQMYP--FEGTKPPNTPMQEALLKKAGDQGHPFTFDIPVHLPCSVSLQPAPED 130

  Fly   233 YGAPIGTSYDVRCFIA---DKTDEKFHRRASVKMGVRVIYRTDVFHQHLAPEQYAAFAGRQNIAQ 294
            .|.|.|..|:|:.:||   |..|||..::.:.::.:|.|        ..||.:.||         
Zfish   131 AGKPCGVDYEVKAYIANEEDNIDEKVEKKDTCRLIIRKI--------QYAPAELAA--------- 178

  Fly   295 SPPASATPPSCGEGGEQHTTHTQQQSQSQPSSGSKHKSKSERGDSFPKLRLSPKSFRFSGRFGRS 359
                                                                             
Zfish   179 ----------------------------------------------------------------- 178

  Fly   360 KSEIEKCPNDPFHSYSKSFQEHCDSMLPPHTGAGVTGGIGGVSVGPCGGPQGSVDKPFLLHDGRV 424
                                                            ||:..::|.|:..|..:
Zfish   179 ------------------------------------------------GPKADINKQFITADKPI 195

  Fly   425 GLRASLDKGWYTHGEDVQVTVNIRNDSRKTVRKVRVCAIQHVDVCMFNNGKFKNVVADSDNVTPP 489
            .:..|::|..|.||:.:.:.|.:.|::.|.|:|:::...|..||.::...|:...|.:.:     
Zfish   196 HMEVSMEKELYYHGDPIPIKVKVNNETSKVVKKIKINIFQITDVVIYAADKYHKCVLNEE----- 255

  Fly   490 VDRTVAAGASLNTTVTLRPQRGPT--------KNWIALEDTLQRSTEPEEITGAIAASAIRSPHF 546
                  .|..:|...|...:...|        |..:||:..|:     :|.|.            
Zfish   256 ------FGDQINANSTFEKEYSVTPLLVNNKEKRGLALDGRLK-----DEDTN------------ 297

  Fly   547 VMQNAQLLGGCGHPLGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAIYVSYYVKVKL 611
                          |.|..|:.|                       :.::.:..:.|||.:||.|
Zfish   298 --------------LASSTLLIP-----------------------DMDKQMQGVVVSYKIKVIL 325

  Fly   612 TLSG------MGGELSLKLPFVLVHVDETQRPGFASATLGELRME 650
            .:.|      ...:::.:||.||:    :.:|    |.:.::.:|
Zfish   326 MMGGGLLGSLTSSDVTAELPLVLM----SPKP----AEISDINLE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32683NP_001285084.1 Arrestin_N 135..268 CDD:304627 51/135 (38%)
Arrestin_C 421..632 CDD:214976 41/224 (18%)
arr3bNP_957086.1 Arrestin_N 16..172 CDD:278754 56/165 (34%)
Arrestin_C 192..353 CDD:214976 41/229 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D783081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.