DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32683 and ARRB2

DIOPT Version :9

Sequence 1:NP_001285084.1 Gene:CG32683 / 31970 FlyBaseID:FBgn0052683 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_011522160.1 Gene:ARRB2 / 409 HGNCID:712 Length:440 Species:Homo sapiens


Alignment Length:534 Identity:133/534 - (24%)
Similarity:207/534 - (38%) Gaps:197/534 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 TQRVYKKTSPNCVLTLYLPTREITLTGNNPSVLRGIVYVDPKAIQGYRVYAQLTLTFRYGREDEE 165
            |:||:||:||||.||:||..|:.....:....:.|:|.|||..::..:|:..||..|||||||.:
Human    37 TRRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLD 101

  Fly   166 VMGLRFCNEAIMSLHQIWPRLEEPTPESLSPLQEALMKRLGDGAHPFTLSLSSYAPPSVQLVPAK 230
            |:||.|..:..::.:|.:|.:..| |...:.||:.|:::||..||||..::....|.||.|.|..
Human   102 VLGLSFRKDLFIATYQAFPPVPNP-PRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGP 165

  Fly   231 RYYGAPIGTSYDVRCFIADKTDEKFHRRASVKMGVRVIYRTDVFHQHLAPEQYAAFAGRQNIAQS 295
            ...|...|..:::|.|.|...:||.|:|.||::.:|.:             |:|           
Human   166 EDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKV-------------QFA----------- 206

  Fly   296 PPASATPPSCGEGGEQHTTHTQQQSQSQPSSGSKHKSKSERGDSFPKLRLSPKSFRFSGRFGRSK 360
                                                                             
Human   207 ----------------------------------------------------------------- 206

  Fly   361 SEIEKCPNDPFHSYSKSFQEHCDSMLPPHTGAGVTGGIGGVSVGPCGGPQGSVD--KPFLLHDGR 423
                  |..|                                     |||.|.:  :.||:.|..
Human   207 ------PEKP-------------------------------------GPQPSAETTRHFLMSDRS 228

  Fly   424 VGLRASLDKGWYTHGEDVQVTVNIRNDSRKTVRKVRVCAIQHVDVCMFNNGKFKNVVADSDNVTP 488
            :.|.|||||..|.|||.:.|.|::.|:|.|||:|::|...|:.|:|:|:..::|..||..:.   
Human   229 LHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQ--- 290

  Fly   489 PVDRTVAAGASLNTTVTLRP--QRGPTKNWIALEDTLQRSTEPEEITGAIAASAIRSPHFVMQNA 551
              |..|:..::.....|:.|  .....|..:||:..|:     .|.|...:::.::.        
Human   291 --DDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLK-----HEDTNLASSTIVKE-------- 340

  Fly   552 QLLGGCGHPLGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAIYVSYYVKVKLTLSGM 616
                                                   |.|:|  |..|.|||.|||||.:| .
Human   341 ---------------------------------------GANKE--VLGILVSYRVKVKLVVS-R 363

  Fly   617 GGELSLKLPFVLVH 630
            ||::|::|||||:|
Human   364 GGDVSVELPFVLMH 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32683NP_001285084.1 Arrestin_N 135..268 CDD:304627 49/132 (37%)
Arrestin_C 421..632 CDD:214976 60/212 (28%)
ARRB2XP_011522160.1 Arrestin_N 50..206 CDD:278754 55/169 (33%)
Arrestin_C 225..380 CDD:214976 60/213 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.802101 Normalized mean entropy S2648
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D783081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.