DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32683 and ARR3

DIOPT Version :9

Sequence 1:NP_001285084.1 Gene:CG32683 / 31970 FlyBaseID:FBgn0052683 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_016885007.1 Gene:ARR3 / 407 HGNCID:710 Length:403 Species:Homo sapiens


Alignment Length:603 Identity:134/603 - (22%)
Similarity:217/603 - (35%) Gaps:231/603 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RVYKKTSPNCVLTLYL-------------PTREITLTGNNPSVL---RGIVYVDPKAIQGYRVYA 151
            :|:||||.|..|::||             |..|..|| ...|||   .|:|.|||:.::..:::.
Human     3 KVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIGEFFLT-KVLSVLLSTDGVVLVDPEYLKCRKLFV 66

  Fly   152 QLTLTFRYGREDEEVMGLRFCNEAIMSLHQIWPRLEEPTPES-LSPLQEALMKRLGDGAHPFTLS 215
            .||..|||||:|.||:||.|..:..:...|:.| .|..:|:. |:.|||.|:.:|||.|:||||.
Human    67 MLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVP-AESSSPQGPLTVLQERLLHKLGDNAYPFTLQ 130

  Fly   216 LSSYAPPSVQLVPAKRYYGAPIGTSYDVRCFIADKTDEKFHRRASVKMGVRVIYRTDVFHQHLAP 280
            :.:..|.||.|.|.....|.|.|..::|:.|.|:..:|...:|..|::.||.:            
Human   131 MVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKV------------ 183

  Fly   281 EQYAAFAGRQNIAQSPPASATPPSCGEGGEQHTTHTQQQSQSQPSSGSKHKSKSERGDSFPKLRL 345
             |:|                                                             
Human   184 -QFA------------------------------------------------------------- 186

  Fly   346 SPKSFRFSGRFGRSKSEIEKCPNDPFHSYSKSFQEHCDSMLPPHTGAGVTGGIGGVSVGPCGGPQ 410
                                                     ||..|.               ||.
Human   187 -----------------------------------------PPEAGP---------------GPS 195

  Fly   411 GSVDKPFLLHDGRVGLRASLDKGWYTHGEDVQVTVNIRNDSRKTVRKVRVCAIQHVDVCMFNNGK 475
            ....:.|||....:.|:|.:|:..:.|||.:.|.|:|.|.:.|.::|:::...|..||.:::..|
Human   196 AQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDK 260

  Fly   476 FKNVVADSDNVTPPVDRTVAAGASLNTTVTLRPQRGPT--KNWIALEDTLQRSTEPEEITGAIAA 538
            :...|...:     ...||||.:|.:.:..:.|....:  |..:||:..|:     .|.|...::
Human   261 YTKTVFIQE-----FTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLK-----HEDTNLASS 315

  Fly   539 SAIRSPHFVMQNAQLLGGCGHPLGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAIYV 603
            :.||                                 ||.                ::.:..|.|
Human   316 TIIR---------------------------------PGM----------------DKELLGILV 331

  Fly   604 SYYVKVKLTLS--GMGGELS-----LKLPFVLVHVDETQRPGFASATLGELRMEMERLALHDAPV 661
            ||.|:|.|.:|  |:.|:|:     ::||.||:|    .:|...:|:..::.:|          .
Human   332 SYKVRVNLMVSCGGILGDLTASDVGVELPLVLIH----PKPSHEAASSEDIVIE----------E 382

  Fly   662 GKRNGRRQAQPTSAEIGD 679
            ..|.|..::|......||
Human   383 FTRKGEEESQKAVEAEGD 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32683NP_001285084.1 Arrestin_N 135..268 CDD:304627 51/133 (38%)
Arrestin_C 421..632 CDD:214976 49/219 (22%)
ARR3XP_016885007.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D783081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.