DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32683 and arrb2b

DIOPT Version :9

Sequence 1:NP_001285084.1 Gene:CG32683 / 31970 FlyBaseID:FBgn0052683 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_009301314.1 Gene:arrb2b / 394099 ZFINID:ZDB-GENE-040426-1332 Length:420 Species:Danio rerio


Alignment Length:539 Identity:132/539 - (24%)
Similarity:209/539 - (38%) Gaps:199/539 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VYKKTSPNCVLTLYLPTREITLTGNNPSVLRGIVYVDPKAIQGYRVYAQLTLTFRYGREDEEVMG 168
            |::|...:..||:||..|:.....::...:.|::.:||:.::..:|:..||..|||||||.:|:|
Zfish    21 VFRKGVDHLGLTVYLGKRDFVDHLDHVDPVDGVLLIDPEYLKDRKVFVTLTCAFRYGREDLDVLG 85

  Fly   169 LRFCNEAIMSLHQIWPRL-EEPTPESLSPLQEALMKRLGDGAHPFTLSLSSYAPPSVQLVPAKRY 232
            |.|..:..:|..|.:|.| :|..|  ||.|||.|:|:||..|:||..::....|.||.|.|....
Zfish    86 LSFRKDLFISSFQAYPPLPDERKP--LSRLQERLLKKLGQNAYPFNFTIPQNLPCSVTLQPGPED 148

  Fly   233 YGAPIGTSYDVRCFIADKTDEKFHRRASVKMGVRVIYRTDVFHQHLAPEQYAAFAGRQNIAQSPP 297
            .|...|..::||.|.|...|||.|:|.||::.:|.:             |||             
Zfish   149 TGKACGVDFEVRAFCAKTVDEKTHKRNSVRLVIRKV-------------QYA------------- 187

  Fly   298 ASATPPSCGEGGEQHTTHTQQQSQSQPSSGSKHKSKSERGDSFPKLRLSPKSFRFSGRFGRSKSE 362
                                                                             
Zfish   188 ----------------------------------------------------------------- 187

  Fly   363 IEKCPNDPFHSYSKSFQEHCDSMLPPHTGAGVTGGIGGVSVGPCGGPQGSVD--KPFLLHDGRVG 425
                |..|                                     |||..|:  :.||:.|..:.
Zfish   188 ----PEKP-------------------------------------GPQPMVETTRSFLMSDRSLH 211

  Fly   426 LRASLDKGWYTHGEDVQVTVNIRNDSRKTVRKVRVCAIQHVDVCMFNNGKFKNVVADSDNVTPPV 490
            |.|||||..|.|||.:.|.|::.|:|.|||::|::...|:.|:|:|:..::|..||..:     .
Zfish   212 LEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQVE-----A 271

  Fly   491 DRTVAAGASLNTTVTLRP--QRGPTKNWIALEDTLQRSTEPEEITGAIAASAIRSPHFVMQNAQL 553
            |..|::.::.....||.|  .....|..:||:..|:     .|.|...:::.::.    :.|.::
Zfish   272 DDQVSSSSTFCKVYTLTPTLSNNREKRGLALDGQLK-----HEDTNLASSTIVKD----VSNKEV 327

  Fly   554 LGGCGHPLGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAIYVSYYVKVKLTLSGMGG 618
            ||                                             |.|||.|||||.:| .||
Zfish   328 LG---------------------------------------------ILVSYRVKVKLVVS-RGG 346

  Fly   619 ELSLKLPFVLVHVDETQRP 637
            ::|::|||||:|...:::|
Zfish   347 DVSVELPFVLMHPKPSEQP 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32683NP_001285084.1 Arrestin_N 135..268 CDD:304627 54/133 (41%)
Arrestin_C 421..632 CDD:214976 59/212 (28%)
arrb2bXP_009301314.1 Arrestin_N 31..187 CDD:278754 60/170 (35%)
Arrestin_C 206..361 CDD:214976 59/214 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D783081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.