DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32683 and arrb2a

DIOPT Version :9

Sequence 1:NP_001285084.1 Gene:CG32683 / 31970 FlyBaseID:FBgn0052683 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_009303544.1 Gene:arrb2a / 321378 ZFINID:ZDB-GENE-030131-29 Length:414 Species:Danio rerio


Alignment Length:549 Identity:137/549 - (24%)
Similarity:211/549 - (38%) Gaps:212/549 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DEFGTQRVYKKTSPNCVLTLYLPTREITLTGNNPSVLRGIVYVDPKAIQGYRVYAQLTLTFRYGR 161
            |:.|| ||:||:||||.:|:||..|:.....::...:.|::.|||:.::..:|:..||..|||||
Zfish     3 DKAGT-RVFKKSSPNCKVTVYLGKRDFVDHLDHVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGR 66

  Fly   162 EDEEVMGLRFCNEAIMSLHQIWPRLEEPTPESLSP---LQEALMKRLGDGAHPFTLSLSSYAPPS 223
            ||.:|:||.|..:..:...|.:|    |.||...|   |||.|:|:||..|:||..|:....|.|
Zfish    67 EDLDVLGLSFRKDLYIFTFQAYP----PIPEESKPHSRLQERLLKKLGQNAYPFHFSIPQNLPCS 127

  Fly   224 VQLVPAKRYYGAPIGTSYDVRCFIADKTDEKFHRRASVKMGVRVIYRTDVFHQHLAPEQYAAFAG 288
            |.|.|.....|...|..:::|.|.|...:||.|:|.||::.:|.:             |||    
Zfish   128 VTLQPGPEDTGKACGVDFEIRAFCAKSMEEKNHKRNSVRLVIRKV-------------QYA---- 175

  Fly   289 RQNIAQSPPASATPPSCGEGGEQHTTHTQQQSQSQPSSGSKHKSKSERGDSFPKLRLSPKSFRFS 353
                                                                             
Zfish   176 ----------------------------------------------------------------- 175

  Fly   354 GRFGRSKSEIEKCPNDPFHSYSKSFQEHCDSMLPPHTGAGVTGGIGGVSVGPCGGPQGSVD--KP 416
                         |..|                                     |||..|:  :.
Zfish   176 -------------PEKP-------------------------------------GPQPMVETTRS 190

  Fly   417 FLLHDGRVGLRASLDKGWYTHGEDVQVTVNIRNDSRKTVRKVRVCAIQHVDVCMFNNGKFKNVVA 481
            ||:.|..:.|.|||||..|.|||.:.|.|::.|:|.|||::|::...|:.|:|:|:..::|..||
Zfish   191 FLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVA 255

  Fly   482 DSDNVTPPVDRTVAAGASLNTTVTLRP--QRGPTKNWIALEDTLQRSTEPEEITGAIAASAIRSP 544
            ..:     .|..||:.::.....||.|  .....|..:||:..|:     .|.|...:::.::. 
Zfish   256 QIE-----ADDQVASSSTFCKVYTLTPTLNNNREKRGLALDGKLK-----HEDTNLASSTIVKD- 309

  Fly   545 HFVMQNAQLLGGCGHPLGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAIYVSYYVKV 609
               :.|.::||                                             :.|||.|||
Zfish   310 ---VSNKEVLG---------------------------------------------VLVSYRVKV 326

  Fly   610 KLTLSGMGG--------ELSLKLPFVLVH 630
            ||.:| .||        ::|::|||||:|
Zfish   327 KLVVS-RGGLLSSLLERDVSVELPFVLMH 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32683NP_001285084.1 Arrestin_N 135..268 CDD:304627 52/135 (39%)
Arrestin_C 421..632 CDD:214976 59/220 (27%)
arrb2aXP_009303544.1 Arrestin_N 19..175 CDD:278754 57/172 (33%)
Arrestin_C 194..357 CDD:214976 59/221 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D783081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.