DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32683 and Sag

DIOPT Version :9

Sequence 1:NP_001285084.1 Gene:CG32683 / 31970 FlyBaseID:FBgn0052683 Length:804 Species:Drosophila melanogaster
Sequence 2:NP_033144.1 Gene:Sag / 20215 MGIID:98227 Length:403 Species:Mus musculus


Alignment Length:544 Identity:124/544 - (22%)
Similarity:198/544 - (36%) Gaps:215/544 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VYKKTSPNCVLTLYLPTREITLTGNNPSVLRGIVYVDPKAIQGYRVYAQLTLTFRYGREDEEVMG 168
            ::||.|.:..:|:||..|:.....:....:.|:|.|||:.::|.:||..||..||||:||.:|||
Mouse    13 IFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQEDIDVMG 77

  Fly   169 LRFCNEAIMSLHQIWPRLEEPTPESLSPLQEALMKRLGDGAHPFTLSLSSYAPPSVQLVPAKRYY 233
            |.|..:...|..|::|.:  .....|:.|||:|:|:|||..:||.|:...|.|.||.|.||.:..
Mouse    78 LTFRRDLYFSRVQVYPPV--GAMSVLTQLQESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDV 140

  Fly   234 GAPIGTSYDVRCFIADKTD---EKFHRRASVKMGVRVIYRTDVFHQHLAPEQYAAFAGRQNIAQS 295
            |...|..::|:.|.:|.||   :|..:::||::.:|.:       ||..||.             
Mouse   141 GKSCGVDFEVKAFASDITDPEEDKIPKKSSVRLLIRKV-------QHAPPEM------------- 185

  Fly   296 PPASATPPSCGEGGEQHTTHTQQQSQSQPSSGSKHKSKSERGDSFPKLRLSPKSFRFSGRFGRSK 360
                                                                             
Mouse   186 ----------------------------------------------------------------- 185

  Fly   361 SEIEKCPNDPFHSYSKSFQEHCDSMLPPHTGAGVTGGIGGVSVGPCGGPQGSVDK--PFLLHDGR 423
                                                           |||.|.:.  .|.:.|..
Mouse   186 -----------------------------------------------GPQPSAEASWQFFMSDKP 203

  Fly   424 VGLRASLDKGWYTHGEDVQVTVNIRNDSRKTVRKVRVCAIQHVDVCMFNNGKFKNVVADSDNVTP 488
            :.|..||.|..|.|||.:.|||.:.|::.|.|:|::|...|..:|.::::..:...||..:    
Mouse   204 LNLSVSLSKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEE---- 264

  Fly   489 PVDRTVAAGASLNTTVTL-------RPQRGPTKNWIALEDTLQRSTEPEEITGAIAASAIRSPHF 546
             ....|...::|..|:.|       |.:||     |||:..::     .|.|...:::.|:.   
Mouse   265 -TQEKVQPNSTLTKTLVLVPLLANNRERRG-----IALDGKIK-----HEDTNLASSTIIKE--- 315

  Fly   547 VMQNAQLLGGCGHPLGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAIYVSYYVKVKL 611
                                                          ..:|.|..|.|||::||||
Mouse   316 ----------------------------------------------GIDRTVMGILVSYHIKVKL 334

  Fly   612 TLSGMGGEL-----SLKLPFVLVH 630
            |:||..|||     :.::||.|:|
Mouse   335 TVSGFLGELTSSEVATEVPFRLMH 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32683NP_001285084.1 Arrestin_N 135..268 CDD:304627 54/135 (40%)
Arrestin_C 421..632 CDD:214976 54/222 (24%)
SagNP_033144.1 Interaction with RHO. /evidence=ECO:0000269|PubMed:28753425 11..19 2/5 (40%)
Arrestin_N 23..181 CDD:334019 59/166 (36%)
Arrestin_C 200..361 CDD:214976 54/223 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..403
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.