DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32683 and arrb1

DIOPT Version :9

Sequence 1:NP_001285084.1 Gene:CG32683 / 31970 FlyBaseID:FBgn0052683 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_004912283.1 Gene:arrb1 / 100486349 XenbaseID:XB-GENE-481578 Length:461 Species:Xenopus tropicalis


Alignment Length:548 Identity:138/548 - (25%)
Similarity:207/548 - (37%) Gaps:208/548 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VYKKTSPNCVLTLYLPTREITLTGNNPSVLRGIVYVDPKAIQGYRVYAQLTLTFRYGREDEEVMG 168
            |:||.|||..||:||..|:.....:....:.|:|.|||:.::..:|:..||..|||||||.:|:|
 Frog    50 VFKKASPNGKLTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCAFRYGREDLDVLG 114

  Fly   169 LRFCNEAIMSLHQIWPRLEEPTPESLSP---LQEALMKRLGDGAHPFTLSLSSYAPPSVQLVPAK 230
            |.|..:..::..|.:|    |.||...|   |||.|:|:||:.|:|||..:....|.||.|.|..
 Frog   115 LTFRKDLFVANIQAFP----PVPEEKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGP 175

  Fly   231 RYYGAPIGTSYDVRCFIADKTDEKFHRRASVKMGVRVIYRTDVFHQHLAPEQYAAFAGRQNIAQS 295
            ...|...|..|:|:.|.|:..:||.|:|.||::.:|.:             |||           
 Frog   176 EDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKV-------------QYA----------- 216

  Fly   296 PPASATPPSCGEGGEQHTTHTQQQSQSQPSSGSKHKSKSERGDSFPKLRLSPKSFRFSGRFGRSK 360
                                                                             
 Frog   217 ----------------------------------------------------------------- 216

  Fly   361 SEIEKCPNDPFHSYSKSFQEHCDSMLPPHTGAGVTGGIGGVSVGPCGGPQGSVDKPFLLHDGRVG 425
                  |..|                                 ||  .|.....:.||:.|..:.
 Frog   217 ------PERP---------------------------------GP--QPMAETTRQFLMSDKPLH 240

  Fly   426 LRASLDKGWYTHGEDVQVTVNIRNDSRKTVRKVRVCAIQHVDVCMFNNGKFKNVVA--DSDNVTP 488
            |.|||||..|.|||.:.|.|::.|::.|||:|:::...|:.|:|:||..::|..||  ::||   
 Frog   241 LEASLDKEIYYHGEPINVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAVEEADN--- 302

  Fly   489 PVDRTVAAGASLNTTVTLRP--QRGPTKNWIALEDTLQRSTEPEEITGAIAASAIRSPHFVMQNA 551
               ..||..::.....||.|  .....|..:||:..|:     .|.|...:::.:|.        
 Frog   303 ---DVVAPSSTFCKVYTLTPFLANNREKRGLALDGKLK-----HEDTNLASSTLLRD-------- 351

  Fly   552 QLLGGCGHPLGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAIYVSYYVKVKLTLS-- 614
                                                   |.|:|  :..|.|||.|||||.:|  
 Frog   352 ---------------------------------------GANKE--ILGIIVSYKVKVKLVVSRG 375

  Fly   615 GMGGEL-----SLKLPFVLVHVDETQRP 637
            |:.|:|     :::|||.|:|...|:.|
 Frog   376 GLLGDLASSDVAVELPFTLMHPKPTEEP 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32683NP_001285084.1 Arrestin_N 135..268 CDD:304627 54/135 (40%)
Arrestin_C 421..632 CDD:214976 61/221 (28%)
arrb1XP_004912283.1 Arrestin_N 60..216 CDD:278754 60/172 (35%)
Arrestin_C 235..399 CDD:214976 61/223 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D783081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.