DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32683 and arr3

DIOPT Version :9

Sequence 1:NP_001285084.1 Gene:CG32683 / 31970 FlyBaseID:FBgn0052683 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_012823333.1 Gene:arr3 / 100124859 XenbaseID:XB-GENE-966159 Length:387 Species:Xenopus tropicalis


Alignment Length:541 Identity:118/541 - (21%)
Similarity:203/541 - (37%) Gaps:207/541 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RVYKKTSPNCVLTLYLPTREITLTGNNPSVLRGIVYVDPKAIQGYRVYAQLTLTFRYGREDEEVM 167
            :|:||:|.:..|::||..|:.....::...:.|::.:||:..:..:|:..||.||||||:|.|::
 Frog     6 KVFKKSSADGKLSIYLAKRDYVDHVDHVEPVDGMILIDPEYQKDKKVFVTLTCTFRYGRDDHELI 70

  Fly   168 GLRFCNEAIMSLH-QIWPRLEEPTPE---SLSPLQEALMKRLGDGAHPFTLSLSSYAPPSVQLVP 228
            ||.| .:.:..|| |::|    |.||   :|:||||.|.|:||..|.||..::::..|.||.|.|
 Frog    71 GLSF-KKDLYFLHCQVYP----PLPEDKKALTPLQEKLAKKLGQNAFPFCFNMATDLPCSVTLQP 130

  Fly   229 AKRYYGAPIGTSYDVRCFIADKTDEKFHRRASVKMGVRVIYRTDVFHQHLAPEQYAAFAGRQNIA 293
            .....|...|..::|:.|.|:..:||..|:.||::.:|.:        ..|||            
 Frog   131 GPEDTGKKCGVDFEVKGFCAENVEEKVPRKNSVQLIIRKV--------QFAPE------------ 175

  Fly   294 QSPPASATPPSCGEGGEQHTTHTQQQSQSQPSSGSKHKSKSERGDSFPKLRLSPKSFRFSGRFGR 358
                  ||.|:                                                      
 Frog   176 ------ATGPA------------------------------------------------------ 180

  Fly   359 SKSEIEKCPNDPFHSYSKSFQEHCDSMLPPHTGAGVTGGIGGVSVGPCGGPQGSVDKPFLLHDGR 423
                                                          ||    ....:.|::.|..
 Frog   181 ----------------------------------------------PC----VQTTRQFMMSDRP 195

  Fly   424 VGLRASLDKGWYTHGEDVQVTVNIRNDSRKTVRKVRVCAIQHVDVCMFNNGKFKNVVADSDNVTP 488
            :.|.|||:|..|.|||.:.|.|.|.|::.|.|:|:::...|..||.:::..|:..:|...:    
 Frog   196 LQLEASLNKEIYYHGEPIGVNVKITNNTSKIVKKIKITVEQLTDVVLYSLDKYTKIVCCEE---- 256

  Fly   489 PVDRTVAAGASLNTTVTLRP--QRGPTKNWIALEDTLQRSTEPEEITGAIAASAIRSPHFVMQNA 551
             ::.||||..:.:.:.::.|  .....|..:||:..|:...     |...:::.:|         
 Frog   257 -MNDTVAANGTFSGSYSVTPLLANNREKRGLALDGKLKHGD-----TNLASSTILR--------- 306

  Fly   552 QLLGGCGHPLGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAIYVSYYVKVKLTLS-- 614
                                    ||.                ::.|..:.|||.|:|.|.::  
 Frog   307 ------------------------PGM----------------DKEVLGMLVSYKVRVNLVVARG 331

  Fly   615 GMGGELS-----LKLPFVLVH 630
            |:.|:|:     :.||..|:|
 Frog   332 GILGDLTSSDVLVDLPLTLMH 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32683NP_001285084.1 Arrestin_N 135..268 CDD:304627 52/136 (38%)
Arrestin_C 421..632 CDD:214976 49/219 (22%)
arr3XP_012823333.1 Arrestin_N 17..173 CDD:334019 56/168 (33%)
Arrestin_C 192..355 CDD:214976 49/220 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D783081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.