DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32683 and arrb2

DIOPT Version :9

Sequence 1:NP_001285084.1 Gene:CG32683 / 31970 FlyBaseID:FBgn0052683 Length:804 Species:Drosophila melanogaster
Sequence 2:XP_031753380.1 Gene:arrb2 / 100101741 XenbaseID:XB-GENE-481084 Length:426 Species:Xenopus tropicalis


Alignment Length:567 Identity:147/567 - (25%)
Similarity:214/567 - (37%) Gaps:215/567 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RVYKKTSPNCVLTLYLPTREITLTGNNPSVLRGIVYVDPKAIQGYRVYAQLTLTFRYGREDEEVM 167
            ||:||:||||.||:||..|:.....:....:.|:|.||...::..:||..||..|||||||.:|:
 Frog    26 RVFKKSSPNCKLTVYLGKRDFVDHLDRVDPVDGVVLVDTDYLKDRKVYVTLTCAFRYGREDLDVL 90

  Fly   168 GLRFCNEAIMSLHQIWPRLEEPTPESLSP---LQEALMKRLGDGAHPFTLSLSSYAPPSVQLVPA 229
            ||.|..:..:|..|.:|    |.||...|   |||.|:|:||:.||||..::....|.||.|.|.
 Frog    91 GLSFRKDLFISKFQAYP----PLPEEKKPLTRLQERLIKKLGEQAHPFFFTIPQNLPCSVTLQPG 151

  Fly   230 KRYYGAPIGTSYDVRCFIADKTDEKFHRRASVKMGVRVIYRTDVFHQHLAPEQYAAFAGRQNIAQ 294
            ....|...|..|::|.|.|...:||.|:|.||::.:|.:        ..|||:    .|.|.:|:
 Frog   152 PEDTGKACGVDYEIRAFCAKTMEEKMHKRNSVRLVIRKV--------QFAPEK----PGPQPVAE 204

  Fly   295 SPPASATPPSCGEGGEQHTTHTQQQSQSQPSSGSKHKSKSERGDSFPKLRLSPKSFRFSGRFGRS 359
            :                 |.|                                            
 Frog   205 T-----------------TRH-------------------------------------------- 208

  Fly   360 KSEIEKCPNDPFHSYSKSFQEHCDSMLPPHTGAGVTGGIGGVSVGPCGGPQGSVDKPFLLHDGRV 424
                                                                     ||:.|..:
 Frog   209 ---------------------------------------------------------FLMSDRSL 216

  Fly   425 GLRASLDKGWYTHGEDVQVTVNIRNDSRKTVRKVRVCAIQHVDVCMFNNGKFKNVVA---DSDNV 486
            .|.|||||..|.|||.:.|.|::.|:|.|||::|:|...|:.|:|:|:..::|..||   ..|.|
 Frog   217 HLEASLDKELYYHGEPINVNVHVTNNSSKTVKRVKVSVRQYADICLFSTAQYKCPVAQIEQDDQV 281

  Fly   487 TPPVDRTVAAGASLNTTVTLRP--QRGPTKNWIALEDTLQRSTEPEEITGAIAASAIRSPHFVMQ 549
            ||        .::.....||.|  .....|..:||:..|:     .|.|...:::.::.      
 Frog   282 TP--------SSTFCKVYTLTPLLSNNREKRGLALDGKLK-----HEDTNLASSTIVKE------ 327

  Fly   550 NAQLLGGCGHPLGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAIYVSYYVKVKLTLS 614
                                                     |.::|  |..|.|||.|||||.:|
 Frog   328 -----------------------------------------GSSKE--VLGILVSYRVKVKLVVS 349

  Fly   615 GMGGELSLKLPFVLVHVDETQRPGFASATLGELRMEMERLALHDAPV 661
             .||:::::|||||:|   .:.|...|..|.|....       ||||
 Frog   350 -RGGDVAVELPFVLMH---PKPPENISRPLSEYPQT-------DAPV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32683NP_001285084.1 Arrestin_N 135..268 CDD:304627 55/135 (41%)
Arrestin_C 421..632 CDD:214976 61/215 (28%)
arrb2XP_031753380.1 Arrestin_N 37..193 CDD:395268 60/167 (36%)
Arrestin_C 212..367 CDD:214976 61/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D783081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.