DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17841 and K12H6.6

DIOPT Version :10

Sequence 1:NP_572622.1 Gene:CG17841 / 31965 FlyBaseID:FBgn0028480 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_494378.1 Gene:K12H6.6 / 173629 WormBaseID:WBGene00019686 Length:309 Species:Caenorhabditis elegans


Alignment Length:98 Identity:19/98 - (19%)
Similarity:44/98 - (44%) Gaps:21/98 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 MMIHHVFIGT-------FGLLVVTYIRGGGHCIYSYMFMMEFSTPFVSLRSILS----TMRLKDS 322
            ::.|||.:.:       :.|::...:.|         .:||.::.|:.:||:::    ..:|...
 Worm   149 LLFHHVVVLSAFTICLFYDLMLGIVVAG---------LLMELNSIFLHIRSLMNLYGFDKKLTAF 204

  Fly   323 RVYIANGLLMLATF-FVCRVCMWPYVMWRYSLA 354
            ||.:...::.|..| .:..|.|..:|...:|::
 Worm   205 RVTVILNIITLVVFRLIVNVYMIYFVFASFSMS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17841NP_572622.1 TLC 127..397 CDD:214789 19/98 (19%)
K12H6.6NP_494378.1 TLC 76..269 CDD:214789 19/98 (19%)

Return to query results.
Submit another query.