DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and EB1C

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_201528.1 Gene:EB1C / 836862 AraportID:AT5G67270 Length:329 Species:Arabidopsis thaliana


Alignment Length:233 Identity:67/233 - (28%)
Similarity:104/233 - (44%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQEYEYVNNFKELQKA 85
            |.:||.|.|.|||.||..:|:.|:||.:|.||..::|..:.:.:|.|.:..|||.:.|:|.||..
plant    16 RSEILAWINSTLQLNLSKVEEACSGAVHCQLMDSVHPGTVPMHKVNFDAKSEYEMIQNYKVLQDV 80

  Fly    86 FNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFF-NVNHTKDKCAGYDALVARDHQNIGIGSSKL 149
            |||:.::...||:.|:||..::|.:|..|.:.:. :||..:.   .|.||..|:....|    |.
plant    81 FNKLKITKHIEVSKLVKGRPLDNLEFMQWMKKYCDSVNGGQH---NYHALERREASKGG----KE 138

  Fly   150 TTKDRFRLVKVKTTAIRGKVATCQATINSSLCTGKANQDEDSQH-------TDKKDEDSRDQGSQ 207
            .||      :...|...||.::..|....|...|....:..|.:       |......|:....|
plant   139 ATK------RAAATQQSGKSSSSSAPPRPSSSNGTRKHEPQSNNTGTHHSSTGNHHHSSKPSAKQ 197

  Fly   208 YEDSPGMDSQYKDCRDQDSQYEDSHGK--DSQYKDCRD 243
            .:..|..|.:..:.:    .|.||..|  |..:...||
plant   198 SKPVPAYDEKITELK----LYIDSLEKERDFYFSKLRD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 33/81 (41%)
EB1CNP_201528.1 BIM1 8..261 CDD:227542 67/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.