DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and EB1B

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_201056.1 Gene:EB1B / 836370 AraportID:AT5G62500 Length:293 Species:Arabidopsis thaliana


Alignment Length:297 Identity:67/297 - (22%)
Similarity:120/297 - (40%) Gaps:79/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQEYEYVNNFKELQKA 85
            |.:||.|.|:.|..||..||:..:||..|.::.|.:|.::.:.:|.|.:..|||.:.|:|.:|:.
plant    16 RNEILSWINDRLHLNLSRIEEAASGAVQCQMLDMTFPGVVPMHKVNFEAKNEYEMIQNYKVMQEV 80

  Fly    86 FNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVARDHQNIGIGSSKLT 150
            |.|:.::.|.|||.|:||..::|.:|..|.:.|         |         |..|.||      
plant    81 FTKLKITKPLEVNRLVKGRPLDNLEFLQWLKRF---------C---------DSINGGI------ 121

  Fly   151 TKDRFRLVKVKTTAIRGKVATCQATINSSLCT--------------------------GKANQDE 189
            ..:.:..|:.::...|.|.....:.|:.||.|                          |.:|...
plant   122 MNENYNPVERRSRGGREKSVKGSSKISKSLQTNNMHHPPVATSNKPAGPKQAKSHGIGGGSNSSA 186

  Fly   190 DSQHTDKKDEDSRDQGSQYEDSPGMDSQYKDCRD-----QDSQYED-------------SHGKDS 236
            :.|...|:.||.:......|..  .|..:...||     |..:.:|             :...:|
plant   187 EVQALSKEVEDLKVSVDLLEKE--RDFYFSKLRDIEILCQTPELDDLPIVVAVKKILYATDANES 249

  Fly   237 ---QYKDCRDQGSQYEDSHGMDSQYEDSRDQDSQYED 270
               :.::|.:|      |.|::...|:.::::.:.|:
plant   250 VLEEAQECLNQ------SLGLEGYEEEGKEEEEEEEE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 30/81 (37%)
EB1BNP_201056.1 CH 16..113 CDD:278723 35/96 (36%)
EB1 206..243 CDD:281288 6/38 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.