DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and EB1a

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_190353.3 Gene:EB1a / 823923 AraportID:AT3G47690 Length:276 Species:Arabidopsis thaliana


Alignment Length:270 Identity:60/270 - (22%)
Similarity:120/270 - (44%) Gaps:36/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQEYEYVNNFKELQKA 85
            |.:||.|.|:.|..||..:|:..:||..|.::.|.:|.::.:.:|.|.:..||:.:.|:|.||..
plant    16 RNEILTWINDRLHLNLSRVEEAASGAVQCQMLDMTFPGVVPMHKVNFDAKNEYDMIQNYKVLQDV 80

  Fly    86 FNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHF--------FNVNHT---------KDKCAGYDA 133
            |||:.::.|.|:|.|:||..::|.:|..|.:.|        .|.|:.         |::......
plant    81 FNKLKITKPLEINRLVKGRPLDNLEFLQWLKRFCDSINGGIMNENYNPVERRSRNGKERSVKGSN 145

  Fly   134 LVARDHQ---------NIGIGSSKLTTKDRFRLVKVKTTAIRGKVATCQATINSSLCTGKANQDE 189
            .:.:..|         :..:|.||.:.....:..:|:        |..:..::..:.|....::.
plant   146 KIPKSLQTNNNHPPPNSSSVGLSKASGPKSAKAAEVQ--------ALSKELVDLKISTDLLEKER 202

  Fly   190 DSQHTDKKDEDSRDQGSQYEDSPGMDSQYKDCRDQDSQYEDSHGKDSQYKDCRDQGSQYEDSHGM 254
            |...:..:|.:...|..:.:|.|.:.:..|.....|:  .:|..:|:|....:..|.:.:::.|.
plant   203 DFYFSKLRDVEILCQTPELDDLPIVVAVKKILYATDA--NESALEDAQEYLNQSLGVEDDEAEGN 265

  Fly   255 DSQYEDSRDQ 264
            ..|.|:.:.|
plant   266 GEQLEEEKTQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 29/81 (36%)
EB1aNP_190353.3 BIM1 8..270 CDD:227542 58/263 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.